KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04175Help
Entry
CLIBASIA_04175    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NYN
Motif
Other DBs
NCBI-ProteinID: ACT57409
UniProt: C6XGA6
Position
complement(927212..927760)
Genome map
AA seq 182 aa AA seqDB search
MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQF
SPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFS
GDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIARDPDED
KK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatcctcgtgaaaaaattgctctttttattgacggtgccaacctctatgcttcc
tctaaagcattgggatttgatattgactataggaaacttctcaaagcctttagatcacgc
gctatagtaataagggcatattattacaccacagttgttggagatccagaacaacaattc
tcaccattacaccctttgcttgattggttacactataatggattccaagttgttgcaaaa
gtagccaaagaattcacagagaactgtgggcgaaaaagggtaaagtcgagcatggatgtt
gagttagccgttgatgcattcgaacagtctgaagggctggaacatcttgttatcttttca
ggagacggatgcttcaccaccttggttgcagctcttcaaaggaaagtaaaaaaggttacg
attgtttcaacagtattatccgatccctctatggcttctgatcaattgcgtcgtcaagct
gactacttcatggatcttgcttatttaaaaaatgagattgcacgtgatcctgatgaagat
aaaaagtaa

DBGET integrated database retrieval system