KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04180Help
Entry
CLIBASIA_04180    CDS       T00948                                 

Gene name
ropZ
Definition
(GenBank) DNA-directed RNA polymerase subunit omega
  KO
K03060  DNA-directed RNA polymerase subunit omega [EC:2.7.7.6]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    CLIBASIA_04180 (ropZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:las03021]
    CLIBASIA_04180 (ropZ)
   03400 DNA repair and recombination proteins [BR:las03400]
    CLIBASIA_04180 (ropZ)
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     CLIBASIA_04180 (ropZ)
Transcription machinery [BR:las03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     CLIBASIA_04180 (ropZ)
DNA repair and recombination proteins [BR:las03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      CLIBASIA_04180 (ropZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb6 Thymidylate_kin
Motif
Other DBs
NCBI-ProteinID: ACT57410
UniProt: C6XGA7
Position
928042..928410
Genome map
AA seq 122 aa AA seqDB search
MARTTVEDCIDKVDNRFLLVLLASHRTRHLSQGAKPTVDVGKDKNTVVALREIASGTLSP
DDLEEDFIHSLQKHVEIDEPDSPTENSDFSWHKPEALSFGQMSEGDLLEGINNIVTPDKR
DD
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactactgtagaagattgtattgataaggtagataaccgattcctgctcgtt
cttctggcgagccatcgtacaaggcatctatcccagggagcaaaaccgacagttgacgtt
gggaaggataagaatacggtcgtagcgttgcgcgagattgcaagtggtactttgtcgcca
gatgatcttgaagaggattttattcattctcttcaaaagcatgttgagattgatgaacct
gatagtcctactgagaattctgatttctcatggcacaagccggaggctttgtcatttggg
caaatgtcagaaggagatctcttagaagggatcaataatatagtcactcctgataagaga
gatgattga

DBGET integrated database retrieval system