KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04185Help
Entry
CLIBASIA_04185    CDS       T00948                                 

Gene name
acpS
Definition
(GenBank) 4'-phosphopantetheinyl transferase
  KO
K00997  holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CLIBASIA_04185 (acpS)
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     CLIBASIA_04185 (acpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACPS BRAP2
Motif
Other DBs
NCBI-ProteinID: ACT57411
UniProt: C6XGA8
Position
928660..929058
Genome map
AA seq 132 aa AA seqDB search
MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFS
KAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPF
AQAFVVIESLLI
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgattataggtataggtagtgatatcgttagtattcagcgtattagtaggttgttgcag
agttttaatagaaaatttgagtcgcgttgtttttcttcattggaacaagatgtttgtgat
ctttcttgcaatcgtgttgcttcgtatgcaaagcgttttgcggctaaagaggcattttct
aaagctatcggtactgggatatctaagggagtttcatggaaagatatagaagtttgtcat
ttccctggagggaaaccttatatttctatttcaggtcgcgcttccgatgtactttcttct
cttgttcctaaaggatataagccggtggtccatctaacaataagcgatgatttccctttt
gctcaagcgtttgttgttatagaatctcttttgatatga

DBGET integrated database retrieval system