KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04190Help
Entry
CLIBASIA_04190    CDS       T00948                                 

Gene name
lepB
Definition
(GenBank) type I signal peptidase
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02024  Quorum sensing
las03060  Protein export
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CLIBASIA_04190 (lepB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLIBASIA_04190 (lepB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:las01002]
    CLIBASIA_04190 (lepB)
Enzymes [BR:las01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     CLIBASIA_04190 (lepB)
Peptidases [BR:las01002]
 Serine Peptidases
  Family S26: signal peptidase I family
   CLIBASIA_04190 (lepB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S24 Peptidase_S26
Motif
Other DBs
NCBI-ProteinID: ACT57412
UniProt: C6XGA9
Position
929121..929867
Genome map
AA seq 248 aa AA seqDB search
MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKF
SYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKG
IIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFL
VPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMR
WDRLFKIL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtggatagcaaaaaaatggacatgcagtatattcgggagtgatactctgaaatcaatt
ctgcaagccttattttttgctattttgattcgaacttttttatttcaaccttctgttatt
ccgagtggatctatgatacccactcttttggtgggggattatattattgttaataagttt
tcttatggttattccaaatactcttttcctttttcgtataatttgtttaatgggcgtatc
tttaataaccaaccgcggcgaggagatgtagtggtttttcgttatccgaaggatccatct
attgattacgtgaagagagtaattggcttgcctggcgatagaatatcgcttgaaaagggt
attatatacattaatggtgcaccggttgtacgccatatggaaggatatttttcgtatcac
tataaagaagattggagtagtaatgtccctatttttcaagaaaaattgagtaatggtgtg
ttatataacgttctttctcaagattttttagcgcctagtagtaatatatcggaatttttg
gttccgaaagggcattactttatgatgggcgataatcgtgataaatctaaagatagtcgt
tgggtcgaagttggttttgtaccagaagaaaatctcgtaggacgggctagttttgttctg
ttttctattgggggtgatactccatttagtaaagtatggctttggattccgaatatgcgt
tgggataggttatttaagattttgtga

DBGET integrated database retrieval system