KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04195Help
Entry
CLIBASIA_04195    CDS       T00948                                 

Gene name
rnc
Definition
(GenBank) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:las03019]
    CLIBASIA_04195 (rnc)
   03009 Ribosome biogenesis [BR:las03009]
    CLIBASIA_04195 (rnc)
   03036 Chromosome and associated proteins [BR:las03036]
    CLIBASIA_04195 (rnc)
Enzymes [BR:las01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     CLIBASIA_04195 (rnc)
Messenger RNA biogenesis [BR:las03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     CLIBASIA_04195 (rnc)
Ribosome biogenesis [BR:las03009]
 Eukaryotic Type
  90S particles
   RNase
    CLIBASIA_04195 (rnc)
 Prokaryotic Type
  rRNA processing factors
   CLIBASIA_04195 (rnc)
Chromosome and associated proteins [BR:las03036]
 Eukaryotic Type
  RNA silencing
   microRNA pathway
    Microprocessor complex
     CLIBASIA_04195 (rnc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm DND1_DSRM
Motif
Other DBs
NCBI-ProteinID: ACT57413
UniProt: C6XGB0
Position
929867..930550
Genome map
AA seq 227 aa AA seqDB search
MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF
NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE
SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR
SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcattgcgatattcaactctagaaaaacggataggttatgcttttgctaataga
tctttattagaaaaggcattgactcattccagtatttctcattcatatcaagaaagttat
gaacgactggaatttctgggtgatcgaattcttggtcttttgatatcgacattgttgttt
aatcattttgattctgccaaagaaggagagctttccgttcgctttaattctttagtgagt
gcagaaacttgttcccaagtagcaagagaattagatcttgcttcctttattcgtgtgagt
tctgatctcagaaaagacgtttgcagttttatgacgagtattcaagctgatgttgtagaa
agcttaattgctgctctctatcttgatggcggtattgaagttgcgggcactttcgtagat
aaatattggaaacaacgtgctcttaaaagtggaaagtttcgtcgtgatgctaaaactgaa
ttgcaagagtgggcgcatgcaaaatttggagtaaccccagaatataaagtaacttttcgt
tctggtcccgaccatgatccacgtttcacggtagtagttgagatttcgggacttgctcct
gctcaagggatggattgttcaaaaagagcggcagagcaagtagctgctgcagaagttttg
aagcgtgaggggatttggacgtga

DBGET integrated database retrieval system