KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04205Help
Entry
CLIBASIA_04205    CDS       T00948                                 

Gene name
glmU
Definition
(GenBank) UDP-N-acetylglucosamine pyrophosphorylase protein
  KO
K04042  bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00520  Amino sugar and nucleotide sugar metabolism
las01100  Metabolic pathways
las01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CLIBASIA_04205 (glmU)
Enzymes [BR:las01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.157  glucosamine-1-phosphate N-acetyltransferase
     CLIBASIA_04205 (glmU)
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     CLIBASIA_04205 (glmU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep NTP_transf_3 NTP_transferase Hexapep_2 IspD CTP_transf_3 DUF4954 DUF2064
Motif
Other DBs
NCBI-ProteinID: ACT57415
UniProt: C6XGB2
Position
931604..932932
Genome map
AA seq 442 aa AA seqDB search
MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE
ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM
DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG
LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI
WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL
EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN
VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS
LVFARSRQIVKEDGALSMRKKK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaaacgtcttgctattgtgcttgctgcaggtagagggcatcgtatgaagtct
tcttcctctaaggtgttacagaaaattgctgggaaacctatgatttcccatgttatggaa
accatcgctgcagcaggtattgaaaacgttgctttggttctaggatatggagcagaagaa
attacaaggattaattttcctcctacgttatcagtcgagtattatattcaagattgccaa
caagggactgcacatgccgttttgacagcacaggatgctataaagccaggatacgatgat
gttattatcatgtatggtgatgtaccactggtttcttctcatactttgaaaaaagcaatg
gataaaatagcccaaggatattctatcgcagtcgttggatttaatgcggataatcctaag
ggatatgggcgtttattgataaaaaataatgaaataatagctattcgtgaagaaaacgat
gctacagatgaagaaagaaaaattcattattgtaatagtggattaatggctattgatggc
ttgtatatcatggattggcttctccaaattaagaaaaacaaagtatcacaggagtactac
ctcacagatattattgaaaaagcacgattggatgggaaaagtattgcgagtattgatgtt
aaggaacaagaagtatgcggttgtaataatcgttatgagttgtctttaatcgaaaacatc
tggcaatcacgttatcgtcgccagatgatgatatcaggtgtgacaatgatcgctccagaa
acagtgtttctttctcacgatactattattcaaccagatactgtcattgaaccgcatgtt
tttttcggatgtggtgtcagcattgaaaattatgtacagatacgtgcattttcatattta
gaaggagtacatattggtaaaaaaaccattatcggtccttttgctcgtataagacaggaa
actacaatagaaaaaaatgtccggataggaaatttttgtgaggtaaaaaaggctactatt
aaagaaggaagtaaaattaatcacctcagttatgtcggcgatagtgtagtagggaaaaat
gttaacataggagcaggtactattacctgtaattatgatggtacccataaatataaaacg
catataaatgagaatgctttcataggatctaattcttctttaatcgctcctattactatt
ggtcaaggtacttatgtagcatctggaagcattattacgcaagatactccggaaaattcg
ctcgtattcgctcgatctcggcagattgtcaaggaagatggtgctttgtcaatgcgaaaa
aaaaagtag

DBGET integrated database retrieval system