KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04215Help
Entry
CLIBASIA_04215    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF502
Motif
Other DBs
NCBI-ProteinID: ACT57417
UniProt: C6XGB4
Position
934926..935612
Genome map
AA seq 228 aa AA seqDB search
MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYC
DFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLL
KEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAG
MLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQPESNSVKK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaatctttccatacgtctatttctgcgaaggttcgcaataacttttttgct
ggctttattatatgtgcgccaattgcaatcacaatttggcttagtttgtctttaatacat
tggtttgatggttttatcgtaccatatattcctatgcaatataatcccgaatattattgc
gatttttctattcccgggtttggattattagtcgttatcgttggtattaatattgttgga
ttttttggcagaaatctcttgggcagatttgtcttttttttaagcgaatctattttaaac
aatacgcctattgttcggcatctttataaaagtactaagcagatcattaggactcttctc
aaggaggattcaacctcttttaagaatgcatgtcttgtggaatatcctagtgctggattt
tggtctttatgctttttgactacagaggttaaaggcgagataaaagaaaaattttccaat
ataggctgtgaagatatggtcacagtctttataccaccaactcctttaccaacggctggt
atgctcgtttttgttcctaggaacaaggtgattatgcttaaaatgagtgctgaagattct
gccaaaatgctgatatctggtgggcttctgatccctgataatatcagttacgatgcacaa
cctgaaagtaattctgtaaaaaagtga

DBGET integrated database retrieval system