KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04220Help
Entry
CLIBASIA_04220    CDS       T00948                                 

Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CLIBASIA_04220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:las03400]
    CLIBASIA_04220
Enzymes [BR:las01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CLIBASIA_04220
DNA repair and recombination proteins [BR:las03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CLIBASIA_04220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C DEAD ResIII RecG_wedge SNF2_N AAA_30 tRNA_anti-codon SWI2_SNF2 DUF2075 SecA_DEAD DAP3 cobW Helicase_RecD
Motif
Other DBs
NCBI-ProteinID: ACT57418
UniProt: C6XGB5
Position
complement(935628..937730)
Genome map
AA seq 700 aa AA seqDB search
MRPSFLNPLFAPLSTFRGVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPK
ISEISEERIVTITGYISQHSSFQLQKRRPYKILLNDGTGEITLLFFYRKTEMLKNVFFEG
RKITVTGKIKKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALS
RLPVLPEWIEKDLLQKKSFPSIAEAFNIIHNPRKAKDFEWTSPARERLAYDELLAGQIAL
LLMRKQFKKEIGIPINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQG
DVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMP
QAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATA
PHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLS
EGKKAYWICPQIEEKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNG
TCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHPPL
SKNSYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIAR
KDAKHILTQDPDLTSVRGQSIRILLYLYQYNEAFQFIRAG
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccttcttttctcaatcccctatttgctcctttatcaacttttcgaggcgttggg
aaaaaatattctttgtttttatccaagattatcaattgtggtaacgcaaatgaaacccgt
tttatagatctcttattttatcatccttcatctttcattgaccgtcactatcgtccaaaa
atttcagaaatttcagaagaaagaatagtaacaataacgggttatattagccagcattct
tcttttcaacttcaaaaaagaagaccctataaaattctccttaacgatggaactggtgaa
attaccttattgtttttttatagaaaaaccgagatgttgaaaaatgttttttttgaaggg
agaaaaattaccgtcacaggaaaaatcaaaaaactcaaaaatcgcattatcatggttcat
cctcattatatttttcataattctcaagatgtaaacttcccgcttattgaagcagtttat
tctctcccgacaggcttatcagtagatcttttcaaaaaaattatcgttgaagcactatca
agattacccgtattacctgaatggatagaaaaagatttattacaaaagaaatcctttcct
tctatagcagaagcattcaatattattcataatccccgtaaagcaaaagattttgagtgg
acatccccagcgagagagcgacttgcgtatgatgaattattagcaggacaaattgcatta
ttgttaatgcggaaacaatttaaaaaagagattggtattccaatcaatgttgaagggaaa
attgctcaaaaaattttgcgaaatatccctttttctccaacaaaaagtcaagaatccgct
atcaaagatattctgcaggatatgtcacaaaaaaatagaatgctccgtattctacaaggt
gatgtaggctctggaaaaacactggttgcattaatagcaatggcagcagcagtggaagca
ggaggtcaagcagttatcatggcacctattgggattctagcacaacaacattatgaattt
atcaaaaaatacacgcaaaatacccaaattattgtcgaaattattacaggaaatatgcca
caagcccatagaagaaaagcactagaacgaatcgctcacggtcaagcgcacatcatcatt
ggcactcatgctctttttcaggattccattcaatattataaacttattttagttattgtc
gacgaacaacatcgttttggagtccaacaacgtctcaaattgactcaaaaagccacggct
ccccatgttttactcatgacagccactcctattccccgcacacttgttctcacttcttta
ggggatattgatatttctaaaataacggaaaaacctgcaggcagaaaacctattaaaact
gttatcattcctattaacagaatagacgaagtcattgaaagactcaaagttgttttatca
gagggtaaaaaagcctattggatttgtcctcaaattgaagaaaaaaaagaatcaaacttt
cgttcggtagtagaacgctttaatagcctgcatgaacattttacctcgtctattgctata
attcatggacgcatgtccgatattgacaaggaatcagtaatggattcttttaaaaatgga
acatgtaaattattaattgcaacaaccgtcattgaagtcggaatcgatgttgttgatgcc
tcaattataatcatagaaaacgcagaacattttggactcgcacaactacatcaattacga
ggacgcgttggacgcggcgaagaaatatccagttgtattctcctatatcatcctcctctg
agcaaaaacagttatacaagactatcagtattgaaaaatacagaagatggatttctgatt
gccgaagaagatttaaaacaacgcaaagaaggagaaatcctcggcatcaaacaatctgga
atgcctaaatttcttattgctcaacctgaattgcatgattctttgttagaaatagcacgt
aaagatgccaaacatattctcacacaagatccagatctgaccagtgtccgaggacaatct
atccgaatacttttatatctctaccaatacaatgaagcgttccaatttatcagggcagga
taa

DBGET integrated database retrieval system