KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04225Help
Entry
CLIBASIA_04225    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
  KO
K09159  antitoxin CptB
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
Prokaryotic defense system [BR:las02048]
 Toxin-antitoxin system (TA system)
  Type IV TA system
   CptA-CptB
    CLIBASIA_04225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh5
Motif
Other DBs
NCBI-ProteinID: ACT57419
UniProt: C6XGB6
Position
937816..938112
Genome map
AA seq 98 aa AA seqDB search
MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK
WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatatgaatctgcagtgtcgcaaaattgtctatcgttgttggcggagaggg
acacgtgaaatggatttgattttggggtcttttgttgatcatttcattttagagctgagt
tcagttgagttgaccatgcttgaatctattatagaagaagatgattctaatctttttaaa
tggtttacaggaatggaaaaaccaccagaatatttgcgtacacctatttttaaaaaaata
tacgattattattctaacaatttagatcgtaaaaacatgctaggaagtctgcaatga

DBGET integrated database retrieval system