KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04250Help
Entry
CLIBASIA_04250    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57424
UniProt: C6XGC1
Position
complement(946575..946724)
Genome map
AA seq 49 aa AA seqDB search
MNTRIIGTVLMLAISPLLFSCSSKKGGEKKGAEKKTSAPLKNGKNQSRR
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaagaataataggaaccgtattaatgcttgctattagtcctcttttatttagc
tgttcttctaaaaaaggaggtgaaaaaaaaggtgcggagaaaaaaacttctgctccgttg
aaaaatggtaaaaatcaatccagaagatag

DBGET integrated database retrieval system