KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04255Help
Entry
CLIBASIA_04255    CDS       T00948                                 

Definition
(GenBank) DNA helicase II
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03420  Nucleotide excision repair
las03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CLIBASIA_04255
   03430 Mismatch repair
    CLIBASIA_04255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:las03400]
    CLIBASIA_04255
Enzymes [BR:las01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CLIBASIA_04255
DNA repair and recombination proteins [BR:las03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     CLIBASIA_04255
   MMR (mismatch exicision repair)
    Other MMR factors
     CLIBASIA_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 AAA_11
Motif
Other DBs
NCBI-ProteinID: ACT57425
UniProt: C6XGC2
Position
complement(947244..949301)
Genome map
AA seq 685 aa AA seqDB search
MQQDDQKSHFSHILKGDFVPSCVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVL
IARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKH
GEVVGLPTDFAILDSAESRTIIKQLLKDLQIDDKDYDPHEVIEKIDYWQNRGWNPKDIPQ
SSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDE
YQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANI
IKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSIHVSQSDNSELSTII
QEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYF
RLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDSGQFRPQIR
QSLQNFVKDIRRWNNCSKKMDPAPIANMILEQSGYMAMWKNNKSSEKSQERLDNLRELLS
IIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLPHQ
LSINEGNVEGERRLAYVGITRAKKKCHLFYTINRRTHDFTRVERYQPSQVSQFLLELYDP
SHTQEIIYDDIYGTFSEHWNQIPEP
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacaagacgatcaaaaaagccatttttctcacatattaaaaggcgattttgtccct
tcgtgtgttcctaactatcttaaagggctcaatgctcaacaaactcatgctgttacaatc
cccgatgatactccgctcctcatattagcaggagctggtactggcaaaacgacagtattg
atagcacgtatgttgcatttaatctgtcacaaggaaatccctccctcgaaaattcttgcc
atgacttttaccaatcaagcaattcaagaaatgaaaaatagattagcttgttatttagga
gaaaagattccaaggattcaaacttttcattctttctgtgcaagcattttacgcaaacat
ggagaagtagtcggtcttcctactgattttgccatcctcgattcagctgaaagtcgcaca
attatcaaacaattactcaaagatttacaaattgacgacaaagattatgacccccatgag
gtgatcgaaaaaatagattattggcaaaatcgcggttggaatccaaaagatattccacaa
tcctctttaactgaagatgcagagattccaaaagcaatctatattcaatatgtcgcctat
ctccagaaaacaaaaagttgtgatttcggcggattaatcataaaaaccattgaagtattg
catcatccacatgttttgaaaaagtatcatgaaaaaattccttatatcatggtggatgaa
tatcaagatatcaatacccctcaatatctattattacgattattatgtcaaaaagaagac
tccaaacaaggcgcccgtatatgttgtgttggtgacgaaaatcagtgtatttatgaatgg
cgtggtgcacaattttctcatatcctcaattttcaaaaagattttaaagatgctaatatt
atcaaacttgaacaaaattatcgttcaactactcacattctcaatacggctaacaagcta
atttcccataataaacagcgctttgataaaaaactctttacccaacgtgattgtcatgat
gatgcaaaagtcagcatacatgttagtcaaagtgataactctgaattatctacaatcatc
caagaaattataaatatccaaaatacagggatgtctttaaacaacatagccatccttgta
cgcacatcttggcaaacacgcaaatttgaagatgcatttcttgaacaagaaatcccccat
aaggtgataggaggtagtttttatgaccgtcaagaaattcgcgatgccctcgcttatttt
cgcttagtatgccaagaacatagagatgaggattttaaacgtatcatcaactgtcctaaa
agaggcataggaaaagaaagcttacacaaaattcaatatcatgcttctcaacatcacatt
tccttactacaagcaagtgaaaaattgattgatagcggtcaatttcgacctcaaatacgc
caatcattacaaaattttgtcaaagatattcgtcggtggaataattgttccaagaaaatg
gaccctgcccctattgcaaacatgattcttgaacaaagtggttacatggcaatgtggaag
aataataaatcttcggaaaaatcacaggaacgtcttgataacctacgagaacttctatcc
attatagaaaaacatgaaacattagaaggctttgttctccaggctcccctgagagagaat
cttggttcattcatacccgattctaattgcatccaaatcatgactttacatgctgccaaa
gggctagaatttgatactgtcttcatttcaggatgggagcaaggattacttcctcaccaa
ctctcaatcaacgagggtaatgtagaaggagaacgccgactcgcatacgtaggcattacc
cgtgcaaaaaaaaaatgtcatctcttctatactatcaatcgacgaacgcatgactttacc
cgcgtagaaagatatcaaccatcgcaagtatcacagtttttattagagttatacgatcct
tctcatacccaagaaatcatttatgacgatatttatggcactttttctgagcactggaat
caaatacccgaaccataa

DBGET integrated database retrieval system