KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04260Help
Entry
CLIBASIA_04260    CDS       T00948                                 

Definition
(GenBank) OmpA/MotB
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA RnlB_antitoxin
Motif
Other DBs
NCBI-ProteinID: ACT57426
UniProt: C6XGC3
Position
949458..950030
Genome map
AA seq 190 aa AA seqDB search
MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD
TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI
GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI
QIFPRGNIKK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaagaattaggtttgtctatgttcataatgacgactatctctggatgtggtttg
gctagcagagaaaagaaaaaggtatttttgcataaatcgaatgatacagatatcgtcaat
aaaagatttgggagctctttagataaagcagaagatgaatttcagatgcaattacaggat
acgggtatagttgttagtcgtataggtgatatgattacatgttatataccagtacatgtt
tcttttgtatcagaggtttttttagaaaaaaaatttttacctatgttacagttgattgcg
actattttaaataaatttcccagtacagtcattgcaattcagagtcatacagattccatt
gggacgttaaaaaataatcttttgatttcacaggaaagagctgatgttattaagagttat
ttgatacaaaggggagtgtcatccaacagattcatatctgtgagaggattcgcttataag
tatcccattgatacaaatgatactaaagtaggacgtcagaataatcagcgcatagaaata
cagatatttccgagaggaaatatcaaaaaataa

DBGET integrated database retrieval system