KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04275Help
Entry
CLIBASIA_04275    CDS       T00948                                 

Gene name
thyA
Definition
(GenBank) thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00240  Pyrimidine metabolism
las00670  One carbon pool by folate
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CLIBASIA_04275 (thyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CLIBASIA_04275 (thyA)
Enzymes [BR:las01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     CLIBASIA_04275 (thyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylat_synt DUF3311
Motif
Other DBs
NCBI-ProteinID: ACT57429
UniProt: C6XGC6
Position
952937..953731
Genome map
AA seq 264 aa AA seqDB search
MHQYLDLLRHVIKFGSDRRDRTGVGTRSTFGYQMRFDLSKGFPLLTTKKVHWKSVVHELL
WFLRGDSNVSYLHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDGNVIDQISSIVQSLR
ADPYSRRHIVSAWNVALIDKMALPPCHCLFQFYVDNGKLSCQLYQRSGDVFLGIPFNIAS
YSLLTMMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPNIVDLL
SFRYEDFTLRSYEPHAAILAKVSV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagtatttagatcttcttcgtcatgttattaaatttggttctgatcgtagagac
cgtacaggcgtaggaacgcgtagtacttttggttatcaaatgcgttttgatttatctaaa
ggttttcctttgctaacgaccaaaaaagtacattggaaatctgttgttcatgaacttctt
tggtttttaaggggagatagcaatgtctcttatcttcatcgccatggtgtgagtatatgg
gatgaatgggctgataaagatggtgaattaggtcctatatacggagtacaatggcgttct
tggcctgactatgatggaaatgttattgatcaaatttcctctattgttcagagtctgcgt
gctgatccatattctcgccgtcatatagtatcagcctggaatgttgctttgatagacaaa
atggcattaccaccgtgtcactgtctttttcaattttacgttgataatggtaagttatca
tgtcaattatatcagcgttcgggagatgttttccttggaataccattcaatattgcatcg
tattcgcttttgacgatgatgttggcaagtgtcatcggattccagtatggagaatttatt
catacgcttggggatgtgcacttatataataaccattttgaacaagctgatttacaactt
tctcgatctccaagaactttgcctcaaatgatcattaatccaaatattgtggatttatta
tcattccgatacgaagatttcactcttaggtcttatgaaccacatgcggctattttagct
aaggtatcagtatga

DBGET integrated database retrieval system