KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04285Help
Entry
CLIBASIA_04285    CDS       T00948                                 

Definition
(GenBank) HflK protein
  KO
K04088  membrane protease subunit HflK [EC:3.4.-.-]
Organism
las  Candidatus Liberibacter asiaticus psy62
Module
las_M00742  Aminoglycoside resistance, protease FtsH
Brite
Enzymes [BR:las01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     CLIBASIA_04285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Band_7 Band_7_1
Motif
Other DBs
NCBI-ProteinID: ACT57431
UniProt: C6XGC8
Position
954362..955429
Genome map
AA seq 355 aa AA seqDB search
MSYDKNNSDWRPTRLSGSNGNGDGLPPFDVEAIIRYIKDKFDLIPFFKSYGSVYIILLLI
GSFCAFQSIYIVHPDERAVELRFGKPKNDVFLPGLHMMFWPIDQVEIVKVIERQQKIGGR
SASVGSNSGLILTGDQNIVGLHFSVLYVVTDPRLYLFNLENPGETLKQVSESAMREVVGR
RFAVDIFRSQRQQIALEVRNLIQKTMDYYKSGILINTISIEDASPPREVADAFDEVQRAE
QDEDRFVEESNKYSNRVLGSARGEASHIRESSIAYKDRIIQEAQGEADRFLSIYGQYVNA
PTLLRKRIYLETMEGILKKAKKVIIDKKQSVMPYLPLNEAFSRIQTKREIRWYQS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatgacaagaacaatagtgactggcgtcctactagattaagtggttccaatggt
aacggtgatggtcttcctccttttgacgttgaggcaatcattcgttatataaaggataag
ttcgatctgatacctttttttaagagttatggctctgtttatattattcttttattgata
ggttcattttgtgcttttcaatcaatatatattgttcatcctgatgagagagccgtagag
ttacgctttggtaaaccaaaaaatgatgtttttttacctggtttacacatgatgttttgg
ccgattgatcaagtcgaaattgtgaaggttatagagcgacagcagaagataggagggcgg
tctgcaagtgttggctctaatagtggattgattcttactggggatcaaaatatcgtcggt
ttacatttttctgtcttgtatgtcgtgaccgatcctcgcttatatctattcaatttagag
aatcctggagaaactttaaaacaagtctctgaaagtgctatgcgtgaggtggttggaaga
agatttgcagttgatatttttcgatctcaacgtcaacaaatagctttagaagtaagaaat
ctcattcaaaagaccatggattattataaatccgggatattgatcaatacaatttccatt
gaagatgcttctcctcctcgggaagtggcggatgcttttgatgaagtgcaacgtgcagag
caggatgaggatcgttttgttgaagaatccaacaaatattctaatcgggtattaggatca
gctcgcggtgaagcctctcatattcgtgagtcttctattgcttataaggatcgcatcatt
caagaagcacagggagaagcagatcgtttcttgtctatttatggacagtatgttaatgca
cctacattgcttcgcaaaagaatatatctagaaaccatggaaggtattttaaagaaagca
aaaaaagttattattgataaaaaacagtccgttatgccttatttacctctcaatgaagct
ttttctcgtattcaaacaaaaagggaaattaggtggtatcaatcatga

DBGET integrated database retrieval system