KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04295Help
Entry
CLIBASIA_04295    CDS       T00948                                 

Definition
(GenBank) phosphoserine phosphatase SerB
  KO
K01079  phosphoserine phosphatase [EC:3.1.3.3]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00260  Glycine, serine and threonine metabolism
las00680  Methane metabolism
las01100  Metabolic pathways
las01120  Microbial metabolism in diverse environments
las01130  Biosynthesis of antibiotics
las01200  Carbon metabolism
las01230  Biosynthesis of amino acids
Module
las_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CLIBASIA_04295
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLIBASIA_04295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:las01009]
    CLIBASIA_04295
Enzymes [BR:las01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     CLIBASIA_04295
Protein phosphatases and associated proteins [BR:las01009]
 HAD phosphatases
  Other HAD phosphatases
   CLIBASIA_04295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD Hydrolase Hydrolase_3 HAD_2 S6PP DUF4392
Motif
Other DBs
NCBI-ProteinID: ACT57433
UniProt: C6XGD0
Position
complement(957481..958374)
Genome map
AA seq 297 aa AA seqDB search
MALIATLITHRSHPILNISLVKQIMQIVNSSIFYWLADSIACDIILPLEGMIDHHRSKIL
SIIADKPIDLIIHRHENRRKNLLIADMDSTMIEQECIDELADLIGIKEKVSLITARAMNG
EIPFQDSLRERISLFKGTSTKIIDSLLEKKITYNPGGYELVHTMKQNGASTLLVTGGFSI
FARFIAQHLGFDQYYANRFIEKDDRLTGQVMEPIIDGTAKSQILLEAIQKLQINPEDTIA
VGDGNNDLDMLRVAGYGVAFHAKPALAKQAKIRIDHSDLEALLYIQGYKKDEIVKSP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggctcttattgctacacttataactcatcgctctcatcctatactgaatatctccctt
gttaaacaaataatgcagatagtaaattcttctatattttactggctcgcagattctatt
gcctgtgatatcatccttcctttagaaggaatgatagatcatcatagaagtaaaatactt
tctattattgcagataaacctattgatcttattatacatcgacacgaaaatagacggaaa
aatcttctcatcgccgacatggattctactatgatagagcaagaatgcattgacgaactt
gcagatttaataggaataaaagaaaaagtttctcttattaccgctcgtgcaatgaatgga
gaaataccttttcaagattcacttcgtgaaagaatatcgctattcaaaggaacttccaca
aaaattattgattctctccttgaaaaaaaaattacatataatcctggaggatatgaactc
gtccatactatgaaacaaaacggtgcttctactcttctagttacaggtggattctcaatt
ttcgctcgttttattgctcaacatcttggatttgatcagtattatgcgaatcgtttcata
gagaaagatgatagattgacaggacaagtgatggaaccaattattgatggtacagcaaaa
tcacaaattctactagaagccatacaaaaactgcaaattaatcccgaagataccattgcc
gtcggtgacggtaacaatgatcttgatatgcttagagtagcaggatatggagttgctttc
catgctaaaccagcccttgcaaagcaagcaaaaatacgtattgatcatagcgatcttgaa
gccttattatatattcaaggatataagaaagacgagatcgtaaaatctccttaa

DBGET integrated database retrieval system