KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04335Help
Entry
CLIBASIA_04335    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57439
UniProt: C6XGD6
Position
963499..963660
Genome map
AA seq 53 aa AA seqDB search
MFYDLFKSRTMHYLKGKSSRKECFLAIFNPLIECLDFKEIVEDKENFPSLTIR
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
atgttttacgatctatttaaatcaaggactatgcactacttgaagggaaaaagtagcagg
aaagagtgttttcttgcgatcttcaatcctctaatagaatgtttggattttaaagagata
gtagaggataaagaaaactttccttctcttacgattagatga

DBGET integrated database retrieval system