KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04340Help
Entry
CLIBASIA_04340    CDS       T00948                                 

Definition
(GenBank) probable multidrug resistance transporter protein
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:las02000]
    CLIBASIA_04340
Transporters [BR:las02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    CLIBASIA_04340
Antimicrobial resistance genes [BR:las01504]
 Gene variants
  Phenicol resistance genes
   Transporters
    CLIBASIA_04340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_2
Motif
Other DBs
NCBI-ProteinID: ACT57440
UniProt: C6XGD7
Position
complement(963946..965142)
Genome map
AA seq 398 aa AA seqDB search
MEFVIVIAMLMAINSLGIDIILPCLPKISDSLHLSNENYGQHLISFYLIGYGIAQIFYGP
LSDRFGRKIVMMFGLVIHIISTFIMVTINSFTGMLCMRLIQGIGGAAPRIITISIIRDIY
DGRDMAKVLSIAMMIFMIMPILAPSIGQATVALSGGWIGIFVCMGVITTFITLWYYIRFP
ETLDPRDVRPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQL
GNLFPIAFAVGGFAMSIASFINSRLVEKFGIRRVSHYSLLIFFMITGSWLLVQITSNHPI
HLLIFIAFFFLASFQFGLINSNFSSISMEPFSHLAGTASSIFGFINTVISTILGIIIGQS
FNGTTYPITIGFFGIAVSSFICILIVEKNQMFRKTELR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgtcatagttatagcaatgttgatggctattaattctcttggcatagatata
atactcccatgtttgcctaagattagtgattctttgcatctcagcaatgaaaattacgga
cagcatttaatatctttttatcttatcggctatgggatagctcaaattttttacggacct
ttatcagaccgttttggtcgtaaaattgtaatgatgtttggactagttatacatattatc
tctacattcatcatggtcactattaattcatttactggaatgctttgtatgcgcttgatc
caaggcataggaggggctgctcctcgtattattaccatttcaattattcgcgatatttat
gatggacgcgacatggctaaggtcttatctatagccatgatgatttttatgattatgcca
atattagcacctagtataggtcaagccacggttgccttgtcaggtggttggatcgggatt
tttgtttgtatgggagtaatcactactttcattacactttggtattacatacgtttcccc
gaaacactcgatccgcgcgatgtgcgtcctttgaatttatatgctatactacatagcttt
tctcttatattcaaacatcgcgcttctaccttgtacaatattgctaacagcttaactatg
ggagcaatactaggatttgtaaactcctcgcagcagatctatgtgggcatctatcagtta
ggaaatttgtttcctatagcttttgcagtaggtggattcgctatgtctattgcctctttt
atcaattcccgtctagtcgaaaaattcggcatacgccgagtatcacattattctttgctg
atttttttcatgattacaggatcgtggcttttagtacaaattacttctaatcaccctatt
cacttactgattttcatcgcatttttctttttagcatcgtttcaatttggattaatcaat
tccaattttagtagcatctctatggagccattttcacatttagccggaacagcatcatct
atatttggctttattaatacagtgatcagcacaattttaggaataataataggacaatca
tttaatggaacaacttatcctattaccatcggatttttcggaatagcagtctccagtttt
atttgcattcttatagttgaaaagaatcaaatgtttaggaaaacagaactacgatag

DBGET integrated database retrieval system