KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04345Help
Entry
CLIBASIA_04345    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
  KO
K07390  monothiol glutaredoxin
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
Chaperones and folding catalysts [BR:las03110]
 Protein folding catalysts
  Protein disulfide isomerase
   CLIBASIA_04345
Mitochondrial biogenesis [BR:las03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    CLIBASIA_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin SH3BGR GST_N_3 FERM_C
Motif
Other DBs
NCBI-ProteinID: ACT57441
UniProt: C6XGD8
Position
complement(965254..965574)
Genome map
AA seq 106 aa AA seqDB search
MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALR
QSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtagtgttaatagcatcattcaaaacgaaatcaaaaaaaatgatgttgttttg
tttatgaagggtacccccacatctccacgctgtggtttttctgggaaagtagtacaagtt
cttgatagtcttggtgtatcttataaaggaatagacgtacttgcagatgatgccttacgt
caaagtataaaggaatattcaaattggccaactattcctcaactctatgtcaaaggtgat
tttattggtggttgcgatattgtgtgtgaaatgtttgaatctggtgaacttcacgaaatt
ttaagtatagatagaatatag

DBGET integrated database retrieval system