KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04365Help
Entry
CLIBASIA_04365    CDS       T00948                                 

Gene name
purS
Definition
(GenBank) phosphoribosylformylglycinamidine synthase, PurS protein
  KO
K23264  phosphoribosylformylglycinamidine synthase subunit PurS [EC:6.3.5.3]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00230  Purine metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
Module
las_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLIBASIA_04365 (purS)
Enzymes [BR:las01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     CLIBASIA_04365 (purS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PurS
Motif
Other DBs
NCBI-ProteinID: ACT57445
UniProt: C6XGE2
Position
complement(969219..969473)
Genome map
AA seq 84 aa AA seqDB search
MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE
SICQNLLANPVIEDYDIKVQKSSS
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaagccaatgttgtcgttaaacttaagaaagatgtcctagatcctcaagggaaa
gcattaaaaaccgccctttcgaatattggattccataatattaatcagattcgccaagga
aaaatttttgacatagaaatggatgaaacgctctcggatattgcagaagaagaactagaa
tctatctgtcaaaatcttcttgctaatcctgtcatcgaagactacgatatcaaagttcaa
aaatcgtcaagttag

DBGET integrated database retrieval system