KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04420Help
Entry
CLIBASIA_04420    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57456
UniProt: C6XGF3
Position
complement(981215..981382)
Genome map
AA seq 55 aa AA seqDB search
MIDSALCKFCTQTVIGYIAEFMKMMFIKNPYSFKNYQARLEFSIPKDSNDLYIKL
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattctgctctctgcaaattttgtacccagactgtgattggatatatcgcagaa
tttatgaaaatgatgtttataaaaaatccttactctttcaagaactaccaagctcgttta
gagttttctataccaaaagattctaatgatctttatatcaaattataa

DBGET integrated database retrieval system