KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04430Help
Entry
CLIBASIA_04430    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57458
UniProt: C6XGF5
Position
complement(982923..983066)
Genome map
AA seq 47 aa AA seqDB search
MTKGKKKPDIIRLEYLDRGNTFSSPPEGYRTYYFGACVHHKRFIRCF
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggaaaaaagaaacctgatattattcgccttgagtatttagatcgagggaat
acgttctcctctcctccggaagggtatcgtacttattattttggagcatgtgtccatcat
aaaagatttattcgatgcttttaa

DBGET integrated database retrieval system