KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04440Help
Entry
CLIBASIA_04440    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_30
Motif
Other DBs
NCBI-ProteinID: ACT57460
UniProt: C6XGF7
Position
complement(983468..983800)
Genome map
AA seq 110 aa AA seqDB search
MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR
KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggagagtgttttaggagttaatgtcctccaagatatcaaccttcctactcccaataat
ctcccctattacacccctactcaattagggaaaaaactggctactaaaccaagtgctata
aaggttaataaaaaacttagggaatggggatttcttttagaagaacatgaatctgggagg
aaacgagatgttttaacccctaaaggggcaaaagggggaggacgatattttgatacgggt
aagaaacgctctgacggtacaatagttcaacagattaaatggcacccccctattgtagag
tctttagcccctgagtttggaggggtgagatga

DBGET integrated database retrieval system