KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04460Help
Entry
CLIBASIA_04460    CDS       T00948                                 

Gene name
uvrB
Definition
(GenBank) excinuclease ABC subunit B
  KO
K03702  excinuclease ABC subunit B
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CLIBASIA_04460 (uvrB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:las03400]
    CLIBASIA_04460 (uvrB)
DNA repair and recombination proteins [BR:las03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     CLIBASIA_04460 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      CLIBASIA_04460 (uvrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrB Helicase_C ResIII UVR AAA_30 DEAD AAA_19 Microtub_bd AAA_16 SRP54 DUF87
Motif
Other DBs
NCBI-ProteinID: ACT57464
UniProt: C6XGG1
Position
complement(986465..988882)
Genome map
AA seq 805 aa AA seqDB search
MPKKTRSFPKKDSRIQSISTRVDDLDYFSFEEKQLEVDKTMVADAMRRIRSEAGKHRKNA
AKRMLIHQRENTASKGEFQSQSSISMSEKQTREISEQTMTPSVQALARLIQSDNPLLKNG
KIWTPHRSWSINNHSKDITFFQMQTDYHPSGDQPAAIAQLLKGIHSREKVQLLLGVTGSG
KTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFKNFFPHNAVEYFVSYYDYYQPEAYVPR
TDTYIEKESSINEQIDRMRHSATRSLLERNDCIVVSSVSCIYGIGSVESYSQMIVQLKIG
DSVEQKELLSSLVKQQYKRQDIGIIRGTFRVCGDSIEIFPSHLEDVAWRVSMFGNDIEEI
SEFYPLTGQKIRNVETIKIYANSHYVTPRPTLNTAMKYIKEELKMRLIELEKEGRLLEAQ
RLEQRITYDLEMLETTGSCQSIENYSRYLTGRNPGEPPPTLFEYIPEDSLLFVDESHVTI
PQISGMYRGDFHRKATLAEYGFRLPSCMDNRPLRFEEWNCLRPTTIVVSATPGSWELEQC
QGIIVEQIIRPTGLVDPPVEIRSARTQVEDVYDEINLAAQQGLRILLTVLTKRMAEDLTE
YLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPECGLVAILDAD
KEGFLRSKTSLIQTIGRAARNVNSKVILYADTITKSIQLAIDETTRRREKQLEHNKKHNI
NPQSVKEKIMEVIDPILLEDAATTNISIDAQQLSLSKKKGKAHLKSLRKQMHLAADNLNF
EEAARIRDEIKRLKSSPYFQGLDDS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaaaaactcgctctttccctaaaaaagattctcgcatacaatcgatcagcacc
cgtgtcgatgatctggattatttttcatttgaagaaaagcaacttgaagtagataaaaca
atggttgccgatgcgatgcgtcgtatccgttctgaagcgggtaaacatcgcaaaaatgcg
gcaaaacgcatgcttatccatcagcgagaaaatacagcttcaaagggtgaatttcagtct
caaagctctatctctatgtcagagaagcagacgagagaaatttctgaacaaacgatgact
ccatcagtgcaagcacttgctcgtttaatccaatcagacaaccctcttctcaaaaacggt
aaaatttggacacctcatcgttcttggtccataaataatcattcaaaggatatcacattc
tttcaaatgcaaacagattaccatccttctggagaccaacctgctgctattgcacaactt
ttaaaaggaattcattcaagagaaaaagtacagcttttactcggagtgactggatccgga
aaaacttttactatggcgaaagtaatcgaagcaatgcagcgacctgctatcgtgatggca
cctaacaaaatcttagcggctcaattgtattcagaatttaagaatttttttccccataac
gccgttgaatatttcgtttcttactatgattattatcaaccagaagcgtatgttccccga
acagatacgtatattgagaaagaatcttctattaacgaacaaattgatcgtatgcgccac
tctgctactcgctctctcttagaacgcaatgattgcatcgtcgtctcttcagtgtcttgt
atctatggtataggatctgttgaatcatattctcaaatgattgtacaactaaaaattggt
gattcggtagaacaaaaagaattactttcttctttagtcaaacaacaatacaagcgccag
gatataggaattatacgcggaacatttcgagtttgtggcgattcaatcgagatttttcct
tctcatcttgaagatgtagcatggcgtgttagcatgtttggtaatgatatcgaagaaatt
agcgaattttatcctctaactggtcaaaagattagaaatgtcgaaacaatcaaaatatat
gctaattcccattatgttacgccacgacctacccttaataccgccatgaaatatattaaa
gaagagcttaagatgcgtcttattgaactggaaaaagaaggaagattacttgaagcacaa
cgtcttgaacaacgaatcacttacgatttagagatgttagaaactacaggatcttgtcaa
tctattgaaaactactctcgctatcttactggacgcaatccgggcgaacctcctccgacg
ctttttgaatatattcctgaagattcgttattatttgttgatgaaagtcatgtaactatt
cctcaaattagtggtatgtatcgcggtgattttcatcgtaaagcgaccttagccgaatat
ggttttcgtcttccttcttgtatggataatcgtcctttgcgttttgaagagtggaattgc
ctaaggccaaccactatcgtcgtttccgctactcctggatcatgggaattagaacaatgt
caaggcatcattgtcgaacaaattattcgtcctacaggattggttgatccccctgtagag
attcggtctgctcgcactcaggtagaagatgtttatgatgaaatcaatttagcagcccaa
caaggtttacgcattttattaacagttcttaccaaacgaatggcagaagatttaacggaa
tatctttatgaacgcaacattcgtgtccgctatatgcattctgaggtaaaaacactagaa
cgtatcgaaatcatacgcgatcttcgtcttggaaaatttgatgtccttgtcggaataaat
ttattacgtgaaggactagatatccctgaatgcggtcttgttgctattttagatgcagat
aaggaaggttttttacgctctaaaacctctttaatacaaaccattggtcgtgcggcccgt
aacgtcaatagcaaagtcattctttacgctgatacgattaccaaatctattcaattagct
attgatgagactactagaagacgagaaaagcaactcgagcataacaaaaaacataatatt
aatccccaatccgtgaaagaaaaaatcatggaagtgattgatccgattctactagaagat
gctgcaacaactaatatcagcattgacgcacaacaattatctctgtccaagaaaaaagga
aaagcacatttaaaatcgctacgaaaacaaatgcatcttgctgctgataatttaaatttt
gaagaagcagctcgtatccgcgatgaaattaaaagattaaaaagctcaccttattttcaa
ggtttagatgattcttaa

DBGET integrated database retrieval system