KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04490Help
Entry
CLIBASIA_04490    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mpv17_PMP22 Kei1
Motif
Other DBs
NCBI-ProteinID: ACT57470
UniProt: C6XGG7
Position
992073..992309
Genome map
AA seq 78 aa AA seqDB search
MINQILIDRSVVLLNLIGNPFSGFYAIRFSLLRSVDQSLLPPWQQFLFYLLPVAVLVPFI
SFFPFLIDAFALGLQDPH
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgattaatcaaatacttatagatcgttcggtcgtacttttaaacttgatcggcaatcct
tttagcggcttttatgccatacgattttcacttcttcgatcggttgatcaaagtctttta
cctccttggcagcaatttcttttttatcttcttccagttgccgttctagtgccgtttatc
tctttttttccgtttctaattgatgctttcgctctaggtcttcaggacccccattga

DBGET integrated database retrieval system