KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04530Help
Entry
CLIBASIA_04530    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57478
UniProt: C6XGH5
Position
complement(1003186..1003443)
Genome map
AA seq 85 aa AA seqDB search
MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGETLPK
GGGRKISLDSNNLSTELRSQNFLRK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaagggattaatagtggcttctctaatatcatcaaccgttataatgagtggg
tgttccgagactttagatccggagaatggaataagagaactaggagcgagaatgaagcaa
gagcgaaaaaaagctgatcaacccatcggaggaggaaaaacaggggaaaccttaccaaaa
ggtggtggcagaaagatatctttagacagtaataacctgtcaactgaacttagatcacaa
aattttttaagaaaataa

DBGET integrated database retrieval system