KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04535Help
Entry
CLIBASIA_04535    CDS       T00948                                 

Definition
(GenBank) ribonucleotide-diphosphate reductase subunit beta
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm
Motif
Other DBs
NCBI-ProteinID: ACT57479
UniProt: C6XGH6
Position
complement(1003628..1004005)
Genome map
AA seq 125 aa AA seqDB search
MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL
NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA
ELKWD
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcgagatgaatcactgcatctcaattttggtattgatgtcatcaaccaaattaaaatc
gaaaacccccatctttggacaaaagagttccaacaaaaaagtcgcaccatgctccatgaa
gctaccctcctcgaaatcgcctatgcacatgaaacaatgccaaaagggttcgtggggtta
aatgctccctcatgtgaacaatatatgcagttcatcgccaatcgtcgttgtcaccaaatc
ggtttagaacctttgttcaaatatacagaaaaccctttcccttggatgagtgaagtaata
gatttgaaaaaggaaaaaaacttcttcgaaactcgggtcacagaatatcaacaaggagca
gagttgaaatgggattaa

DBGET integrated database retrieval system