KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04560Help
Entry
CLIBASIA_04560    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACT57483
UniProt: C6XGI0
Position
complement(1009605..1010192)
Genome map
AA seq 195 aa AA seqDB search
MKSKNILIVSTLVICVLSISSCDLGDSIAKKRNTIGNTIKKSINRVIQENNKPRNMTIFK
TEVKRDIRRASRLSLEEKSKNADKPTVIENQADNINIEVEVATNLNPNHQASEIDIAIEN
LPDLKSNHQASEIDIAIENLPDLKSNHQASEIDIAIENLPDHQVDRNHTLSNLRGACYQP
SLVSNSSLKLWDVAF
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaaaaatattctcattgtatcaacgttagtcatctgcgttctatctattagt
agttgtgacctcggtgattccattgcaaaaaaaagaaatacaataggtaacacgatcaag
aagtccataaatagagttatacaagagaataataaacctcgaaatatgactatatttaaa
acagaagttaagagagatatacgtcgtgctagcaggctatctttggaagagaaatccaaa
aatgcagataaacctactgtgatagagaatcaagctgataatatcaacattgaggtagaa
gtcgctactaatctgaacccaaaccatcaagctagtgagatcgatattgcaatagaaaac
ctgcctgatttgaaatcaaaccatcaagctagtgagatcgatattgcaatagaaaacctg
cctgatttgaaatcaaaccatcaagctagtgagatcgatattgcaatagaaaacctgcct
gatcatcaagttgatagaaatcataccctcagcaacctcagaggtgcttgttatcagccc
tctcttgtgtctaactcgtcgttaaagctatgggacgtagcattttaa

DBGET integrated database retrieval system