KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04590Help
Entry
CLIBASIA_04590    CDS       T00948                                 

Gene name
mvaD
Definition
(GenBank) diphosphomevalonate decarboxylase/isopentenyl-diphosphate delta-isomerase
  KO
K01597  diphosphomevalonate decarboxylase [EC:4.1.1.33]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00900  Terpenoid backbone biosynthesis
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLIBASIA_04590 (mvaD)
Enzymes [BR:las01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.33  diphosphomevalonate decarboxylase
     CLIBASIA_04590 (mvaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MDD_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACT57489
UniProt: C6XGI6
Position
complement(1016383..1017450)
Genome map
AA seq 355 aa AA seqDB search
MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL
GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA
GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM
DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ
AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL
DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgtccctatcactccgtcacattctacatcgttatatcggtgaatgtaatcctaaaatc
aacgaaaaaagtagcgcctttcttcctagtaatattgcattatgtaaatactgggggaaa
agggattcaaaattaaatcttccactcaataattctctttctttgagtcttgggcacttg
ggcactataacacatatcacagtgatcgatagtgatgccgattgcatcatactcaatggt
caaaaaatttcttctcagagtagtttttttaaaaaaaccactcaattttgcgatcttttt
cgtcaattttcaaaagtatatttcctaatagaaacgtctaataatatccctactaaggca
ggattagcctcttctgcttctggttttgcagcattaactttagcattatttcgaatttat
tctattcctgaaaaaagtgaatcactatctcgtgttgcacgtcttggatcaggtagtgct
tgtcgatctttctatagaggtttttgcgaatggatatgtggtacagatcagaatggtatg
gatagttttgctgtaccattcaacaatcaatggcctgatttacgtatcggacttttaaag
ataattgatagagaaaaaaaaataggatcgcgtgaagcaatggagattactcgacaccac
tcgcctttttttacacaatggacacaacaaatttccacagatctcgcacatattaaacaa
gctattatcgatcaagatttcatcaaacttggagaagttgctgaaaaaaatgctttaaaa
atgcacgcaactatgattgctgcctctccacctttgttatattggcaaaaagaaacaatt
caggggatggaaagagtatgggatgcacgccaacaatctattcctatttattttactcta
gatgcaggacctaatttaaaactcttgtttacgcacaaaatagaagaaacaatcaaacaa
ttttttccagaaataacaataattgatcctcttgatagtccagacttatggagcactaaa
gatagtctttcacagaaaaattcgatagagttagggatttcaaaatag

DBGET integrated database retrieval system