KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04595Help
Entry
CLIBASIA_04595    CDS       T00948                                 

Definition
(GenBank) GHMP kinase
  KO
K00869  mevalonate kinase [EC:2.7.1.36]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00900  Terpenoid backbone biosynthesis
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLIBASIA_04595
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.36  mevalonate kinase
     CLIBASIA_04595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C GalKase_gal_bdg Tropomyosin_1
Motif
Other DBs
NCBI-ProteinID: ACT57490
UniProt: C6XGI7
Position
complement(1017407..1018381)
Genome map
AA seq 324 aa AA seqDB search
MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY
CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL
QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL
IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM
NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV
NCHMHAKGIDIVPITPSHSTSLYR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgggacaatgcttgcataaaatttgtgttagtgctcctggaagtttagtcttgatggga
gaacatggggttctgcatgggcatgctgcgcttgtttttgccataaataagcgggtaatc
ctgtatttgacattacgcaaagatcgcctaatcaacattgattcttctttgggtcaatat
tgtggatctcttgatcttgcgatgttccatccctcgttttcttttattataatggcgatt
aatcatataaaaccatcatgtggttttgatctaaaagtcatctctcagcttgattctcaa
ttgggtcttggctcttctgctgccattacagttgctataacagctgctttactcacactc
caataccacaaagaaccttctcctgacgaaatactcacaacagcacacgcaattgtgtta
aaagtacagggaatctcttctggaattgatcttgctgcttccatccatgggggtttgatt
tgttatcaaatgccaaaatacagcatagaaaagattgattttatttttcctatacatctg
atttattcagggtataaaacccctacagctcaggttttaaaaaaaatttcttatatagaa
atagaataccccgagatcaacgaaataaaccaaaaaatttatgcccttatgggaaaactc
agccaaatctcttgtcaagctctccgtaataaaaacttaaaagtactagcacaagcaatg
aatagacagcagggattattagaaaccttaggcgtttctgattcaaaactctccgagatt
gtttggaaactcagagaacaaccccatattatggcttctaaaatttcaggatcaggatta
ggagactgcgtcattgctctcgggaaaggagatttaaactctcttccttatcaatctgtc
aattgtcacatgcatgcaaaaggaatagacattgtccctatcactccgtcacattctaca
tcgttatatcggtga

DBGET integrated database retrieval system