KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04675Help
Entry
CLIBASIA_04675    CDS       T00948                                 

Definition
(GenBank) HemY domain-containing protein
  KO
K02498  HemY protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    CLIBASIA_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemY_N ANAPC3 BUD22
Motif
Other DBs
NCBI-ProteinID: ACT57506
UniProt: C6XGK3
Position
complement(1036301..1037779)
Genome map
AA seq 492 aa AA seqDB search
MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFA
VSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEY
LVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKA
LDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKG
DMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYT
HLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEI
FLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEW
KIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPH
IRQPDDPGIKEQ
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtcttatacgttatttttttgtaatttccttggtgatctgtagttttatcata
gtctctcattacccagaggatgtgtccattacttggggcaatcgattatatcgaacaagt
ccttttgtgatattatcaatcctttatttttttctctttgcatggattttattatttgca
gtctcacgattttttttatcatgccccgctatgctttttcatatgcttcataagcgcaac
tatgataagggatataaggcgttatatacgggtctcatgtcaattgccgcacataatata
ccattggctcgcaaaatgcattcttacgtatctcaacagcatacttttcataacgaatat
cttgtttatctcttagaagtgcaaattgctttagctgaaagacaatacaatattgcacat
gaaaaattagaaatgatgctacagatacccgctactagagaatttgcagtgtatagttta
tactttgaatcctgccgtataggcgatttaaattcagctcagcgttatgcaacaaaagct
ttggatatttctcctgatgcaccttgggttactgaagcagtcgtacaacagtatgtatta
gcaaaagaatggtctagagccattacctttttaaatcaaaagaagaagaatgctaaagaa
tggaatcgtaatagagcaatacttctcatagcccgctctttagaaaatgcagacaaaggt
gacatgattgcttcttatcatgatgcaatagaatctttgaaactatgtgataattcaatc
atggcatcaatatgtgctgccaaatctttaatttcccaaaataaaaaaagaaaagcagaa
gtaattttagaaaaaatatggaaggttaatcctcatcctgaaattgccaacatttatacg
cacctcttatcagaaaatacagtaggaaagttgaagagagcactaaggctagaagagatc
aataaggaaagtgtagaatccttggttattgtttctaagattgctttggaaatgggcagt
attgatcaggcacacgcaaaagcaatgcttgctatgaaaatcgcccctagaaaagaaatc
tttttactgcttgctcaaatagagcaagcaaattcgcataacacagataaaattctatac
tggacacaaagcgccttgcacgcaatgccagatccgctatggatatcagatgatggctat
ttatcatctgtatggcttcctctatcacctataagtaaaacactatgttattttgaatgg
aaaattcctactaaaagcccagaatatatttcttctgaaaacatcaatttttctctagaa
atggcgtatcctgcggatgatctgcaaagtatgctaaacaatggcaagaaaaaccatcta
cctagcattaaaaaagtttcttcctttgaagatagtactattcatcctttagatcctcac
attcgacaaccggatgatcctggaattaaggaacagtaa

DBGET integrated database retrieval system