KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04755Help
Entry
CLIBASIA_04755    CDS       T00948                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00020  Citrate cycle (TCA cycle)
las00640  Propanoate metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01120  Microbial metabolism in diverse environments
las01130  Biosynthesis of antibiotics
las01200  Carbon metabolism
Module
las_M00009  Citrate cycle (TCA cycle, Krebs cycle)
las_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLIBASIA_04755 (sucC)
   00640 Propanoate metabolism
    CLIBASIA_04755 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CLIBASIA_04755 (sucC)
Enzymes [BR:las01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CLIBASIA_04755 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACT57522
UniProt: C6XGL9
Position
1050723..1051919
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFK
ELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYL
SLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQ
GQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQ
ELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVG
GGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLE
GANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcaagctaaggcattgttaagaaaatataatgttccagttgct
aagggtgtggtcatttcgtctgttcatgcggcagaatcggcgattaaaactcttcctggt
ccgttgtatgttgtcaaaagtcagattcatgctggagggcgtggtaaaggacgttttaaa
gaattacccgctgattcgaaaggtggggtacgtgtcgaaagctctcttaaatctgtcata
tctgatattcgagagattctcggttctacactcataacaaaacaaactggacctacgggg
agcagagtgaattgtgtatatgttgaagatggtgctgatatattaagagaactatattta
tctcttttagtagatagaacatcaggaatggttgcctttattgcctctactcaaggaggg
atggatatagaggaagtcgccaaagattaccctcagaagattttcaaactacttattgat
cccttgataggggtgacttctgaagatgttgccagcttgtgtgatatgcttgaattacaa
gggcaagctcgtattgatggcggcgatctttttcctaacctttataaagctttctgtgat
aaagatatgagtttgctggaaattaatccactaattattatgaaaaacggtcggttaaga
gtattagattcaaaaatatcttttgacgacaatgcgttatatcgccatcttgatattcaa
gaattacgcgatgtttcagaagaagacagtagagaaatagaagccaaacaacataatctt
tcttatatagcacttgatggtaatatcggttgtatggttaatggagctggtttagctatg
gctactatggacatcattaaattatacggaggagcacctgctaattttcttgatgttgga
ggaggagccgatcaagataaagtagctgctgcttttaagattatcacgtcagattcttct
gttaaaggaatattaatcaatatatttggagggattatgagatgtgatgtgctagtaaaa
ggtattttatctgctgttaaagaagtaaagatcaatattccccttgtgatgcgtcttgaa
ggggccaatgtagatattggaaatcgattgattgcggaaagtggtttgaacgttattact
gcaattgatttagatgatgctgctcagaaaatagtgcatgcagtgaaaggagtttga

DBGET integrated database retrieval system