KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04775Help
Entry
CLIBASIA_04775    CDS       T00948                                 

Gene name
lpdA
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00010  Glycolysis / Gluconeogenesis
las00020  Citrate cycle (TCA cycle)
las00260  Glycine, serine and threonine metabolism
las00280  Valine, leucine and isoleucine degradation
las00310  Lysine degradation
las00620  Pyruvate metabolism
las00630  Glyoxylate and dicarboxylate metabolism
las00640  Propanoate metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01120  Microbial metabolism in diverse environments
las01130  Biosynthesis of antibiotics
las01200  Carbon metabolism
Module
las_M00009  Citrate cycle (TCA cycle, Krebs cycle)
las_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
las_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLIBASIA_04775 (lpdA)
   00020 Citrate cycle (TCA cycle)
    CLIBASIA_04775 (lpdA)
   00620 Pyruvate metabolism
    CLIBASIA_04775 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    CLIBASIA_04775 (lpdA)
   00640 Propanoate metabolism
    CLIBASIA_04775 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLIBASIA_04775 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    CLIBASIA_04775 (lpdA)
   00310 Lysine degradation
    CLIBASIA_04775 (lpdA)
   00380 Tryptophan metabolism
    CLIBASIA_04775 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:las04147]
    CLIBASIA_04775 (lpdA)
Enzymes [BR:las01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     CLIBASIA_04775 (lpdA)
Exosome [BR:las04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CLIBASIA_04775 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox HI0933_like FAD_oxidored Pyr_redox_3 GIDA DAO FAD_binding_2 AlaDh_PNT_C NAD_binding_8 K_oxygenase Thi4 3HCDH_N FAD_binding_3 Lycopene_cycl Amino_oxidase Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ACT57526
UniProt: C6XGM3
Position
1057278..1058678
Genome map
AA seq 466 aa AA seqDB search
MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYS
HIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNN
KILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVI
GAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSKVSS
VKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQ
FQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVASI
GKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKSDRVEGVHIIGGSAGE
MIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQPIHM
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtttatgatgttgctgttgtgggtggtggtccagctggttatgcttgtgcaataaaa
gctgctcagttaaaaaataaagtcgctataattgaaaaagaaaagacttatggtggaact
tgtttaaatatagggtgtattccttccaaggctttgttacatgcttcggaaatgtatagt
catattgctaaagaagcgggagatttagggataaatattgcatcttgtcatttggatttg
aaaaagatgatgtcttacaagaaatctattgtcgaatccaatactcaagggataaatttt
ctcctaaagaaaaataaaattattacatatcatggatcagcaaggattgtatccaataat
aaaatactggtcaaaggaagttcttcagaagaaacaatagaagcgaagaatatagtcatt
gccactggatcagaggcatctggcttgccgggtatgtcaattgattttgatgagcaagtc
atcgtatcttctacgggtgcattgtcattttcttccgttccaaaaaatttactggtcatt
ggcgctggagtcatcggcttagaattgggttccgtttggacgcgacttggttcttgtgta
aagattattgagcattctggcactattttaaatggaatggacaaagaaatagcagcacat
tgtcttaaaattatgtccaaacagggaatgaattttcagttgaactcaaaagtttcttct
gtcaaaaaggtgaagggaaaagcgcaggtagtctatcgatctactgatgacgagcctata
aatattgaagctgatgccgttttggttgctgcaggacgtaggccgtatacgaaaggttta
ggtcttgaagaaataggtattaatattgatcatcggggatgcattgaaataggagggcaa
tttcaaacatctatttcgactatttatgctattggagatgttgtccgtggaccaatgtta
gctcataaagcagaggatgaaggtattgcggtagctgaaattatttctggtcaaaaaggg
catgttaattacgggattatcccaagtgttgtgtatactcatcctgaagttgcttcaata
ggaaaaaccgaagaacaattgaagtgtgaaaaaaaatcttataaagtagggaagtttccg
tttagtgctaatggtagagcacgttctatgaattccatcgatggttttgtaaaaatattg
gcgaatgagaaaagtgatcgcgtagaaggtgtgcatattataggtggtagtgctggagaa
atgattcacgaagcggcagttttgatggaatttggaggatcttcagaggatctggctcgc
atttgtcatgcgcatccaacaatgtcagaagccgtgagagaggcggcattatcttgtttt
gatcaaccaattcatatgtaa

DBGET integrated database retrieval system