KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04810Help
Entry
CLIBASIA_04810    CDS       T00948                                 

Definition
(GenBank) ABC transporter, nucleotide binding/ATPase protein
  KO
K09013  Fe-S cluster assembly ATP-binding protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:las02000]
    CLIBASIA_04810
Transporters [BR:las02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Orphan ABC ATPase
    CLIBASIA_04810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_18 AAA_23 Cytidylate_kin MutS_V AAA_13 RsgA_GTPase AAA_33 AAA_22 AAA_28
Motif
Other DBs
NCBI-ProteinID: ACT57533
UniProt: C6XGN0
Position
1064211..1064960
Genome map
AA seq 249 aa AA seqDB search
MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG
DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP
DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI
DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE
NGYAELIKE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaataaagaaccttcgtgcaaaaattgtggacacggatacagaaattatccga
ggactgaatttaaaagtagaacccagcgaagtggtagctataatgggtcctaatggatct
ggtaaatcgacgctatcatatcttttgtcgggacataaagactatgaaataacagctgga
gatattctttataaaggcgagagtatcttggattggagtattgtagaaagggcatctaaa
ggaattttccttgctttccaataccctgtagaaatacctggtattatcatgatgcaattt
ctaaaaattgctttgaatgaacagcgtaaagctcgcaatgaaaaagagcttttaattcca
gattttacccgtaaagtgcgaaagattacagccgaattagggataaacatggatatgtta
aaacgcccgctgaatttaggcttttctggaggtgagaaaaagatagctgaaattttgcag
atgcgtcttttagagccgagtttgtgtattctcgatgaaaccgattcaggacttgatatt
gatgctttgaaaattgctgctcagggagtcaacgctctacgttcgcaggatcgttctttt
ttgattattacacattatcagcgtcttttaaattatatcaagccagatactattcatgtc
ctacataatggaaaaattattaaaacaggagattatagtattgcccttgatcttgaagaa
aatggttatgctgaattaataaaagaatag

DBGET integrated database retrieval system