KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04835Help
Entry
CLIBASIA_04835    CDS       T00948                                 

Gene name
kamA
Definition
(GenBank) L-lysine 2,3-aminomutase protein
  KO
K01843  lysine 2,3-aminomutase [EC:5.4.3.2]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00310  Lysine degradation
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CLIBASIA_04835 (kamA)
Enzymes [BR:las01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.2  lysine 2,3-aminomutase
     CLIBASIA_04835 (kamA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12
Motif
Other DBs
NCBI-ProteinID: ACT57538
UniProt: C6XGN5
Position
complement(1068638..1069696)
Genome map
AA seq 352 aa AA seqDB search
MQLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQF
IPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGS
QKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRF
HSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQ
SVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEK
ISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYPPKSS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaattacgtcataaaacactaacgtctgcacaagatttatataatgcaaatctcatc
aagaaagaacaaatcgatgagataaaagaaatttcaaatcattattctattgcgttgaca
cctgttattgccaatctgattaatcctcataatcccaatgatcccattgcccgccaattt
attcctcagaaagaagagttgaatattttaccagaagaacgagaagatcctattggagat
aataatcatagccctttaaaaggcattgtacatcgttatcctgatagaatactgctaaaa
ttattgcatgtatgtcctgtatactgtcgattttgttttcgtagagagatggttggctca
caaaaaggcacggttttatcttctaaagatacggaagctgctcttgcttatattcaagaa
aaatctcaaatttgggaagtgatctttacaggaggggatcctttaattttatcccacaag
cgtttgcaaaaagttttgaaaacattgaggtatattaagcatgttcaaatattacgtttt
catagtcgtgtacctattgttgatcctcaacgtattaatcctgaactcattcaatgttta
aaagaagcgggtaaacctgtatatattgcgatacatgctaatcatccttatgaattttct
gaagaagctattgctgctatttctagactggcaaatgctggcattattcttttaagccaa
tcagtattacttaaaggtattaatgacgatcccgaaattcttgccaatctcatgcgaact
tttgtagaattgcgaatcaagccatattatttacatcacccagaccttgctgctggaaca
agccattttcgtcttaccattgaagaaggacaaaaaattgttgcgagtttaaaagaaaaa
atttcgggactatgccaaccattttatattcttgatcttcctgggggatatggaaaggtg
aaaattgatactcataacatcaaaaaagtaggtaatggatcctattgtattaccgatcac
cataatatagtacacgactatccgccaaaatcatcatga

DBGET integrated database retrieval system