KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04850Help
Entry
CLIBASIA_04850    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: efb-c
Motif
Other DBs
NCBI-ProteinID: ACT57541
UniProt: C6XGN8
Position
1072286..1072417
Genome map
AA seq 43 aa AA seqDB search
MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atggattcgagtagcccaattgcacttgctattcaaaataggcaaattggaggagtggtg
cgatttgattatgattttaagaaaaaatcctatcaaagaaatatcaaaaatcctattcaa
ttagagagataa

DBGET integrated database retrieval system