KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04860Help
Entry
CLIBASIA_04860    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ACT57543
UniProt: C6XGP0
Position
1072588..1072764
Genome map
AA seq 58 aa AA seqDB search
MAKNLVTSGINVNFSPVLDLLYGPETFIAQKRSIFSRIPAKAEESAQLFSRTYIKNPK
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaaaacttggtaacctcaggcatcaatgtgaatttttctccagtccttgatctt
ttatacgggccagaaacatttattgcacaaaaaaggagtattttttcaagaattcccgca
aaagcggaagagagtgctcaattgttctctcgtacctatataaaaaatccaaaataa

DBGET integrated database retrieval system