KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04865Help
Entry
CLIBASIA_04865    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57544
UniProt: C6XGP1
Position
1072985..1073200
Genome map
AA seq 71 aa AA seqDB search
MRWAFKALLALIACKWNLSRIIAVYNAGADQQDPADVIELIYAHVKSGEIKPSRIESAYQ
RIIYLKNKMKT
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgagatgggctttcaaggcgttgttagcactgattgcatgcaaatggaatctatcgcgg
atcattgctgtctataatgcaggtgccgatcagcaagatcctgctgatgtcattgaactt
atttatgctcatgtaaaatcaggtgagattaaaccaagtaggattgagagtgcttatcaa
cgtatcatctacctaaagaataaaatgaaaacctaa

DBGET integrated database retrieval system