KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04875Help
Entry
CLIBASIA_04875    CDS       T00948                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K00228  coproporphyrinogen III oxidase [EC:1.3.3.3]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00860  Porphyrin and chlorophyll metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLIBASIA_04875
Enzymes [BR:las01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.3  coproporphyrinogen oxidase
     CLIBASIA_04875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coprogen_oxidas
Motif
Other DBs
NCBI-ProteinID: ACT57546
UniProt: C6XGP3
Position
1074982..1075905
Genome map
AA seq 307 aa AA seqDB search
MNLCTIEIGCPDDIEERKRISQRKFENLQSIICTEFEKLENEAHENSANRSPKIFTVKHW
LRDKSQKEDLGGGRMATLCAGKVFEKAAVLVSTVYGDLSPDFKDQILGTTKNPYFWATGL
SVIVHPYNPHVPAVHFNIRMIVTGAYWFGGGIDLTPSLESRRHSYDPDVIFFHNTLKEMC
SQHAVANYTHYKEWCDRYFYLPHRQESRGIGGIFFDHLHSSPEMGGIDADFSFISAVGDC
FIKLYPSLVRRNYHHLFSEQDRQEQLIRRGRYAEFNLLYDKGTNFGFKTGGNVESILASM
PPLVAWP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttgtacaatagagataggttgtccagatgatattgaagaacgcaaaagaata
agccaaagaaaattcgaaaatcttcaaagtattatttgtactgaatttgaaaagttagaa
aacgaagcacacgagaattcagcaaaccgttccccaaagatctttacagtaaaacattgg
ttacgcgacaaaagtcaaaaagaagatctcggaggcgggcgtatggcaacgctatgtgct
gggaaagtattcgaaaaagctgccgttctcgtatcaacagtttatggagatttatctcca
gatttcaaagatcaaatactcggaacaacaaagaacccatatttttgggcaacgggtctt
tcggttattgttcatccttataacccgcatgttcctgctgtgcattttaatatacgtatg
atcgtgaccggtgcttattggttcggtggaggaattgatctcaccccatccttagaatcc
cgtcgtcattcctatgatccagatgtgatatttttccataatactctcaaagaaatgtgt
tctcaacatgcagtcgccaattacacacactataaagaatggtgcgatcggtatttttat
ctaccacatcgacaggaatctcggggtattggaggaatattttttgatcatcttcattct
tctccagagatggggggaatagatgcagatttttcttttatctctgctgtcggagactgt
tttatcaaactctatccatcgttagtacgccgtaattatcatcatttattttctgaacaa
gatcggcaagaacagttgattcgtcgtggacgttacgcagaatttaatcttctatatgac
aaaggaacgaactttggatttaaaacaggaggcaatgtggaaagtattttagcatctatg
ccacccttggtagcgtggccatag

DBGET integrated database retrieval system