KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04985Help
Entry
CLIBASIA_04985    CDS       T00948                                 

Gene name
murB
Definition
(GenBank) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00520  Amino sugar and nucleotide sugar metabolism
las00550  Peptidoglycan biosynthesis
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CLIBASIA_04985 (murB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CLIBASIA_04985 (murB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:las01011]
    CLIBASIA_04985 (murB)
Enzymes [BR:las01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     CLIBASIA_04985 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:las01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   CLIBASIA_04985 (murB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MurB_C FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ACT57568
UniProt: C6XGR5
Position
complement(1092920..1093876)
Genome map
AA seq 318 aa AA seqDB search
MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS
DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR
HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR
SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW
QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI
KRLGDFFDHQIVDATKIF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgatatatggaagaatttctcgtcttttgagggaacgaggtaaacaactcagaggcaaa
tttcaagagaattttcctctgaagcaaataacatggtttcgcactggtggtaatgcagaa
gtcatgtttcaacctcaagatattcacgatttaaaatatttcttaacacttttgccaagt
gatattcctatcacgattgtaggactgggttcaaatattttggtacgtgatgctgggatt
agaggtgttgttttacgattatcaaatgctggttttagtaatatagaagtaagaaatcat
tgtgaaatgattgtaggtgctcgttgttcaggaaagtctcttgctaatagcgctttacgt
catggtattgggggttttcattttttttatggtattccgggatcaattggaggtgcagca
tatatgaatgctggtgccaataattgtgaaacttctcaatatgttgtagaagtccatggt
atagatcgtaagggaaatcaacatgttattccgcgagagcaattaaaatatcaatatcgt
tcttcagagattacgaaggatttgatcattacgcatgttgttctgcggggatttccagaa
tctcaaaatattattagtgctgctattgctaatgtttgtcatcatcgggaaacagtacag
ccaatcaaggaaaaaacgggaggttccacttttaaaaatcctacgggacattctgcatgg
cagttaatagaaaaatccggttgtcgtggattagaatttggaggagctaaaatatcagaa
ttgcactgtaattttatgattaacgctgacaatgctactggatatgatcttgaatatctt
ggagaacaagtgcgcaaaaaagttttcaatcaatcaggtattcttctagaatgggaaata
aagcgtctcggagattttttcgatcatcagattgtggatgctacaaaaatattttag

DBGET integrated database retrieval system