KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04995Help
Entry
CLIBASIA_04995    CDS       T00948                                 

Gene name
murG
Definition
(GenBank) N-acetylglucosaminyl transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00550  Peptidoglycan biosynthesis
las01100  Metabolic pathways
las01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CLIBASIA_04995 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CLIBASIA_04995 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:las01011]
    CLIBASIA_04995 (murG)
Enzymes [BR:las01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     CLIBASIA_04995 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:las01011]
 Precursor biosynthesis
  Glycosyltransferase
   CLIBASIA_04995 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_transf_4 Glyco_trans_1_3 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: ACT57570
UniProt: C6XGR7
Position
complement(1095357..1096466)
Genome map
AA seq 369 aa AA seqDB search
MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVS
SQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSM
VHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSS
DLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDEL
GCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAY
YLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEK
LAHVKVDLV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaacaatgttatattattagtagcagggggtacgggaggacatgtattcccc
gcagtggcattatcgcatgaattaaaaaatcgaggatatgctgtctatttaatcactgat
cgtcgtgcaaggtcttttattacagattttcctgctgattccatttatgagattgtttct
tctcaggttcgattttctaatccctttgttttttggaattctttagtgattttatggaaa
gcatttatcgcttctttacgtttgataaaaaaattaaaacctaacgtcgtggtaggtttt
ggaggttatcatagcatttctccgctattagcgggaatgatattacggataccctcgatg
gttcatgaacaaaatgttataatgggaaaagcgaatcgtctcttatcttggggagtacaa
ataatagcaagaggattagtatcttctcagaaaaaagtattattacgcaaaattattgta
acaggtaatcctatacgcagttccttgatcaaaatgaaagatattccgtatcagtctagt
gatttagatcaaccttttcatttattagtatttggaggaagtcaaggggcaaaagttttt
tccgatattgtccctaaaagcattgctcttataccagagatgcagcgtaaacgattagtg
attatgcaacaagtccgtgaagatgataaagaaaaagttcaaaagcaatatgatgaatta
ggttgtaaggctactcttgcttgtttttttaaagatattgaacgatatattgtagaagca
aatttgttgatatgtcgatcaggagctttgaccgtttctgagatagctgttataggacgt
ccagcaattcttgtaccttatcctcattctgttgatcaggatcagctacacaatgcttat
tatttacaagaaggagggggagctaaagttataacagaaaattttctttctcctgaacga
ttggctgaagagctttgttctgctatgaaaaaaccaagctgtttggttcagatggctaag
caagtttctatgaaaggaaaacctcaggctgttttaatgttatcagatttagttgaaaaa
ctagctcatgtaaaagtagatttggtttag

DBGET integrated database retrieval system