KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_05030Help
Entry
CLIBASIA_05030    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57577
UniProt: C6XGS4
Position
complement(1105000..1105377)
Genome map
AA seq 125 aa AA seqDB search
MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQ
PDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKE
IVQQQ
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaacattggatttcattatactcggtgttgtccttgcttctataacaattacg
tattccattaaacatgaaacagaggggaaaaaggaaaaactaagaatcctagaaaataaa
attacctcagaacaaaattatattgatttgctaaaagctcaatgggcgctactaattcaa
cctgatcgaattaaagatctagtctctctttatcaaaaagaattacaattacaagcaact
aatccaattaatttaattacttatgatgatttagcgaggttaaaaaagcacactcttttg
cctgaaaatcgttctaatttacccaagagaactgtagaaaggcgccaacatcgaaaagaa
attgtgcaacaacaatga

DBGET integrated database retrieval system