KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_05090Help
Entry
CLIBASIA_05090    CDS       T00948                                 

Gene name
yajC
Definition
(GenBank) preprotein tranlocase protein
  KO
K03210  preprotein translocase subunit YajC
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02024  Quorum sensing
las03060  Protein export
las03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CLIBASIA_05090 (yajC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CLIBASIA_05090 (yajC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLIBASIA_05090 (yajC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:las02044]
    CLIBASIA_05090 (yajC)
Secretion system [BR:las02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   CLIBASIA_05090 (yajC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC HTH_23
Motif
Other DBs
NCBI-ProteinID: ACT57589
UniProt: C6XGT6
Position
complement(1118386..1118712)
Genome map
AA seq 108 aa AA seqDB search
MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD
SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atatttacaacagtttatgcacaatcagatgctcctgcaattacttctgcgacctctcct
ttagaaatggctggtttgttttttgttttggcagtggtatggtattttctgcttattcgg
ccacaacgtcaacagttacaaagacgtgcagagatgttgcgtaatttgcgcaggggagac
tctatagtcacagcagcaggaattgttgggaaagtcgtgagagttattgatgatttagaa
cttgaagtagaaatagccgaaaatgtgcgagttcgtgttgttcggtcatttgtatctgag
gttcaatcaaagtctgaacctgtatag

DBGET integrated database retrieval system