KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_05180Help
Entry
CLIBASIA_05180    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57607
UniProt: C6XGV4
Position
complement(1135813..1136775)
Genome map
AA seq 320 aa AA seqDB search
MQAGGSLPAGFSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHIGRPL
GKRAIVFVKNDVWIATNNGLISMKNILLQEEKTNLPLSWPIQEQWEQAIMVAPTGWSMIL
WEKRNMLLISCPKNSLLSDKTFVMNVAHNNRWSSFHNWFTQSYVVANENLFFGDYEGTFW
QGDISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQRPYLKLFARANYDHS
YPEFSKETISNNPMDNGIWDNSLWDEVKWTDNLFVTKKKLFQFCQNVVAYGNCLAVGCVI
VSSGKSINDIQINNAKLLVE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaggaggatcgttgcctgcaggattctcatggtcaactgaaagtggtgatggt
ttgtctactttatgcgttttcttatccactcttggtgaagtcgctgtttatggtggagat
aatcctgatgactcctcttctttttctctcaaagcaatttatcatattggacgtcctttg
gggaaaagagctatcgtttttgtcaaaaacgacgtatggattgcaacgaataacggtttg
atttctatgaaaaatattctcttacaggaagagaaaacaaatcttcctttatcttggcct
attcaagaacaatgggaacaagcaattatggtagctccaacagggtggtcgatgattctt
tgggaaaaacgcaatatgttattgattagttgtcctaaaaattctcttctatctgataaa
acgtttgtgatgaatgtggctcataataatcgttggtctagtttccataattggtttact
caatcttatgttgttgcaaatgaaaatcttttttttggagattatgaaggtactttttgg
caaggagatatttcgggatcagataatgcacggccttttatcgggatatacctttctcct
tttcatgcaattgatcctcgtttaggatttcaaaggagagcttgtgtcgctcatctttct
cttcaagcatatcaacgtccctatctcaaattatttgctcgtgctaattatgatcatagt
tatccggagttctcaaaagaaacgatcagtaataatccaatggataatggtatatgggat
aattctttatgggatgaggttaaatggacagataacttgtttgtcacaaaaaagaaacta
ttccagttttgtcaaaatgtagtcgcttatggcaattgtttggcagttggttgtgtcatc
gtttcttctggaaaatctatcaatgatattcaaattaataatgcaaagctcttagttgaa
taa

DBGET integrated database retrieval system