KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_05205Help
Entry
CLIBASIA_05205    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57612
UniProt: C6XGV9
Position
complement(1138539..1138736)
Genome map
AA seq 65 aa AA seqDB search
MEINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRT
SEGYV
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atggagattaatcaggcgtgtgcaatggctactaggaagaaaaatagggattggcaaaga
atagccagcattcctgtaagtattttaaaagactctcatcttctccaagctcatactgaa
ggagatgacgtttgggtcaataagtggctcaataatagagataacgcttcttggcgtact
tcggaaggatacgtataa

DBGET integrated database retrieval system