KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_05330Help
Entry
CLIBASIA_05330    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57632
UniProt: C6XGX9
Position
1155140..1155343
Genome map
AA seq 67 aa AA seqDB search
MWRRVFAITLFSSIPLQKISFLPQIFSLIITCGAQGKYCVLSANFQLNKLDNSKTAKENL
DSFFATY
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
gtgtggcgaagagtattcgctattactttattctcttcaatacctctacaaaaaatatct
ttccttccacaaattttctctcttattataacgtgcggtgcacaaggaaaatattgtgtc
ttatcggcaaattttcaattgaataaactagataatagcaaaacagcaaaagaaaatctt
gattctttttttgcaacatattga

DBGET integrated database retrieval system