KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_05350Help
Entry
CLIBASIA_05350    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Topoisom_I_N FCH JmjN POX
Motif
Other DBs
NCBI-ProteinID: ACT57636
UniProt: C6XGY3
Position
complement(1159267..1159911)
Genome map
AA seq 214 aa AA seqDB search
MQDIEDSIPKITSSTGKCLKFIMRAFGLFDSAEQRKLWSLLRYWSVEFWELLCRTFLWLL
CLGFFTLFAYWFFGEKFSYDVSIKIVLAINVLLFSFVIALLGNPNIEMAKDIAQLFTLID
NIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKI
KSYLTHIKIVRDCLKKDNIHYAKELRNDWIGSNR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatatagaggacagtatacccaaaatcacgtcaagtacaggcaaatgtctcaaa
ttcataatgcgagcattcgggctcttcgattcagcagagcaacgtaagctgtggtctctt
ttacgttattggagtgtcgagttttgggaattgctatgccgaacatttttgtggctactt
tgtttagggtttttcactttgtttgcctattggtttttcggagagaagttctcttatgat
gtatcaataaagatagtgctagcaattaacgtacttctattttcttttgttattgctttg
ttaggtaatcccaacatagaaatggcaaaagatattgcccaattattcacattaattgac
aatatagagaatgggtatggtcaatatttagagaaaataagccaaaaaaacgtagaaaag
gacttttttaattccaagtttttcacgcattttaaagaatatatcgacgaagttgataaa
attcttatgagatatgggatagaaggtattccattaaccgatttcgatcatgagaaaata
aaaagttatctaacgcatattaaaattgtaagggattgtttgaaaaaagataatatccat
tatgctaaagagcttcgtaatgattggatcgggagtaacagatag

DBGET integrated database retrieval system