KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_05470Help
Entry
CLIBASIA_05470    CDS       T00948                                 

Definition
(GenBank) putative phage terminase, large subunit
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terminase_6 Helicase_RecD
Motif
Other DBs
NCBI-ProteinID: ACT57660
UniProt: C6XH07
Position
complement(1184862..1185965)
Genome map
AA seq 367 aa AA seqDB search
MPRLISTDQKLEQELHEMLMHAECVLSFKNFVMRFFPWGIKGKPLEHFSQPHRWQLEFME
AVDVHCHSNVNNSNPTIFKCAISAGRGIGKTTLNAWMMLWLISTRPGMSIICIANSETQL
KNTLWAEVSKWLSMLPHRHWFEMQSLSLHPSGWYAELLEQSMGIDSKHYTITCRTYSEER
PDTFVGPHNTHGMAVFNDEASGTPDIINKSILGFFTELNPNRFWIMTSNTRRLNGWFYDI
FNIPLEDWKRYQIDTRTVEGIDSGFHEGIISRYGLDSDVARIEILGQFPQQEVNNFIPHN
YIEEAMSREAIDDLYAPLIMGCDIAGEGGDKTVVVFRRGNIIEHIFDWSAKLIQETNQEG
CPVGSSI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ttgccccgtttgatttccactgatcaaaagcttgaacaagaattgcatgagatgcttatg
catgctgaatgtgttttgagttttaaaaactttgttatgaggtttttcccttgggggatt
aaagggaaaccgcttgaacacttttctcaaccgcaccgatggcaattagagtttatggag
gcggtggatgtccattgtcattctaacgtaaataattctaaccctacgatttttaaatgc
gctatatccgcggggcgaggtatcggtaaaaccaccttaaacgcatggatgatgctatgg
ttgatatcgacccgtccgggcatgtcgattatttgtattgcgaactcagaaacccagttg
aaaaacacgttatgggcggaagtgtctaagtggctttcgatgcttccccatcgccattgg
tttgagatgcagtcgttatcccttcatccttctgggtggtatgcggaattgttagagcag
agtatggggatagattctaagcattataccataacctgtagaacctactctgaagaacgt
cctgatacctttgtaggccctcacaatactcatgggatggcagtttttaacgatgaagcg
tcgggaactcctgatatcatcaataagtctattcttgggtttttcaccgaacttaatcct
aatcgtttttggattatgacctccaatactcgtaggttaaatggttggttttacgatata
tttaatattcctcttgaagattggaagcgttatcaaattgatacacggacggtagagggg
attgattcaggttttcatgaagggatcatatcccgttatggacttgattctgacgtggct
cgtattgaaattttaggtcaatttcctcaacaagaggtcaataactttattcctcacaat
tacattgaggaagcgatgtctcgagaggcgatagacgacctatacgccccgttaattatg
ggctgtgacatagcgggagaagggggagataagaccgttgttgtcttccgtcgtggtaat
atcattgaacatatatttgattggtcagcgaagcttattcaagagactaatcaagaaggt
tgcccagttggctcatcaatataa

DBGET integrated database retrieval system