KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_05595Help
Entry
CLIBASIA_05595    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57685
UniProt: C6XH30
Position
complement(1214491..1214820)
Genome map
AA seq 109 aa AA seqDB search
MVNFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVE
GGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggttaattttagaaaacttgcggatatgattaaaagcaaagtgttatcccgtggctat
acggttgattccgatgctttagcgagacaactggaagaagacgagcgaagaattcgtcac
tacaaacatgtttattccactcctgaaggtcgtttcgtcttgacagatttgatggttgaa
ggcgggcttttatcatcagtttcaaatgattctgcccaccaacttgcccttttggaggga
aagagaagtttagcggtccacatagcttccaattgtgggcttagttttgaacgaattgta
caaatgtattctgataacccacgatactaa

DBGET integrated database retrieval system