KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_05615Help
Entry
CLIBASIA_05615    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57689
UniProt: C6XH34
Position
complement(1218677..1218793)
Genome map
AA seq 38 aa AA seqDB search
MGRPPETNFKGYIGTPPTIFIKFWNIEESSAILHNNAS
NT seq 117 nt NT seq  +upstreamnt  +downstreamnt
gtggggaggcccccagagactaattttaaaggatatataggcacccctccgacaattttt
ataaaattttggaatattgaagagtcttcagctattttacacaacaatgcttcttaa

DBGET integrated database retrieval system