KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_05660Help
Entry
CLIBASIA_05660    CDS       T00948                                 

Definition
(GenBank) P4 family phage/plasmid primase
  KO
K06919  putative DNA primase/helicase
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    CLIBASIA_05660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PriCT_2 Prim-Pol D5_N SMC_N AAA_16
Motif
Other DBs
NCBI-ProteinID: ACT57698
UniProt: C6XH43
Position
complement(1223914..1226283)
Genome map
AA seq 789 aa AA seqDB search
MPVMQWKEQAKQAIHNGFKLIPLRLGDKRPQRLGKWEEQLLSSEKIDKLPACGFGFVCGV
GEQPLYAFDIDSKDEKTANTFKDTFEILHGTPIVRIGQKPKILIPFRMNKEGIKKKKTTE
STQGHLDILGCGQYFVAYNIHPKTKKEYTWTTPPHRFKVEDTPLLSEEDVEYLFKFFQEI
TVPLVKDKKSIIPSKTWTNNNNRQYTNREITAFLSCFGEEFYNGSHDEWIPVVMAVHHET
RGSSKGKEIARRWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRSTFTSLFYHHGKLIPK
GLLASRFSDAYNKAMFSIYKKGHFLYTADTKAWYKKDKNNVYIWSLTLDKITASIMNFLV
SMKEDVFDLSEEPEDNNKNSKSPRFWFNTDYRRQNVEENSKAKSTAQSLEAGSIFSITSD
LLDSSSRFLGEQDGILDLETGQKVKPTKELYITKSTGTPFVEGEPSQEFLDLVSGYFESE
EVMDYFTRCVGMALLGGNKAQRFIHIRGVGGSGKSTLMNLIKYAFGNQYVINAEASDIMQ
NRPPEAGKANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGGDCMTARLNYGNTYSES
PASFTPFIVPNKHLFVRNPDDAWWRRYIVIPFDKPIANRDASFAQKLETKYTLEAKKWFL
KGVKAYISKGLDVDIPEVCLKAKEEERQGTDTYQAWIDDCCDIGENLWEESHSLAKSYSE
YREQELNYDRKRISTRTVTLNLKQKGFIGGIKREKIEKEWKSKRIIKGLKLKPAFESVDD
NSNIIDFKR
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaatgcaatggaaggaacaggctaaacaagccattcataatgggtttaagctc
atccctttgcgtttaggggataaaagaccacagcgattgggtaagtgggaagaacaacta
ctttcaagtgagaaaatcgacaaacttcctgcttgtggctttgggtttgtctgtggcgta
ggggaacaaccactttacgcctttgatattgattcaaaagacgaaaaaaccgccaatact
tttaaagatacttttgagattcttcatggaacgccgatcgtaagaatagggcaaaagccc
aaaattcttattcctttccgaatgaataaagaagggattaagaagaagaaaacgactgaa
agtacccaagggcatcttgatattttgggttgtggtcaatacttcgttgcctataatatc
caccctaaaacaaaaaaagaatacacatggacgaccccgccccatagatttaaagtggaa
gatacccctttgctttccgaagaagatgttgaatatctttttaagttttttcaagagatt
accgtgccactggtaaaagataaaaaatcgattataccctctaaaacgtggactaacaac
aataatagacagtacaccaatagagaaataaccgcctttttatcttgttttggcgaagaa
ttttacaacggttctcacgatgaatggatacccgttgttatggctgttcatcacgaaacg
agaggatcaagtaaaggtaaagaaatagctagaagatggagtaaacagggatcaacctat
gatgaagagaattttaattataaatgggacaccttcgattttgaagaaataggcgataca
gcaaaaaagcgttctacgtttacttctctgttttaccaccatggaaaattaatccctaaa
ggtcttttagcttctcggtttagcgacgcttacaacaaagcgatgttttcaatatataag
aaaggacattttttatatactgcagatacgaaagcttggtataaaaaggataaaaacaac
gtttatatctggagtttaacactagataaaataaccgcttcaatcatgaactttctggtt
tctatgaaagaagatgtttttgatttgagtgaagaacctgaagataataataaaaattca
aaaagtccaagattttggttcaacactgattatagaagacaaaatgttgaagagaactca
aaggctaaatccactgctcaaagccttgaagctgggagtattttcagcataacgtctgat
ctactggattcttcttctcgttttcttggtgaacaagacgggattctggatttagaaaca
ggacaaaaagtcaaaccaacaaaagaactctatattaccaaatcaacaggaactcctttt
gttgagggtgagccatcgcaagagtttcttgatctagtgtcaggatacttcgaaagcgaa
gaagtgatggactacttcacccgttgtgttggaatggcgttgttaggagggaataaagct
caacgatttattcatattcgaggtgttggaggaagtggtaaaagcaccctcatgaacctt
attaaatacgctttcggaaaccaatacgtcattaatgccgaggcaagcgacattatgcaa
aaccgtcccccagaagcaggtaaagcaaaccctagccttatcagactcatgggatctaga
attgttattatcagcgaaactaatgaaaatgatgagataaacgccgctaaaataaaacaa
atgacaggaggtgattgcatgacagcacgcctcaattacggtaatacctacagtgaatca
cccgctagttttactcctttcatcgtccctaacaaacatctgttcgttagaaatcccgat
gatgcatggtggaggcgatacatcgtaatccctttcgataaaccaatagcaaatagggat
gcatcctttgcccaaaaactagaaaccaaatacaccttagaagcgaagaaatggtttcta
aaaggagttaaagcctacatcagcaagggcctagacgtcgatatacctgaagtatgttta
aaagccaaagaggaagaaagacagggaacagatacttaccaagcgtggattgatgattgt
tgtgatattggtgaaaatctatgggaagagagccacagtttagcaaaaagctacagtgaa
taccgggaacaggagttaaactacgatagaaaacgtatatcaacgagaacggttacgctc
aatcttaaacaaaaaggatttataggagggattaagcgtgaaaaaatagaaaaagaatgg
aaatccaaacgcatcatcaaaggattaaaacttaaacctgcctttgaatcagtggatgat
aatagtaatattatagattttaagagatag

DBGET integrated database retrieval system